Elcatonin Acetate

Nabiochem Ltd.

All of the products from nabiochem are intended for laboratory and research use only, unless otherwise explicitly stated.

Product Description
Cas.No: 57014-02-5
Purity(HPLC): >98.0%
Formula: C146H241N43O47S2
Molecular Weight: 3414.87
Senquence: CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (DISULFIDE BRIDGE: 1-7)
Amino Acid Composition: 10% of theetical
Appearance: White powder
Storage: Store at -20°C. Keep tightly closed. Store in a cool dry place.
Solubility: Reference FAQ
Related Products
Get In Touch

If you have any suggestions or opinions about our products, please leave a message, and we will immediately answer your questions. Thanks for your support.

  • *
  • *
  • *
  • *